Generated on December 19 2025 20:07 PM
Old data? UPDATE !
The score is 50/100
Title
Kosmetik - Paulas Beauty Home
Length : 29
Perfect, your title contains between 10 and 70 characters.
Description
Kosmetik Paulas Beauty Home Kosmetik schoenheit-mesotherapie-microneedling-plasmalifting-wimpernverlaengerung-emmen-luzern-schweiz
Length : 130
Great, your meta description contains between 70 and 160 characters.
Keywords
Very bad. We haven't found meta keywords on your page. Use this free online meta tags generator to create keywords.
Og Meta Properties
Good, your page take advantage of Og Properties.
| Property | Content |
|---|---|
| locale | de_DE |
| type | website |
| title | Kosmetik - Paulas Beauty Home |
| description | Kosmetik Paulas Beauty Home Kosmetik schoenheit-mesotherapie-microneedling-plasmalifting-wimpernverlaengerung-emmen-luzern-schweiz |
| url | https://paulabeauty.ch/de/ |
| site_name | Paulas Beauty Home |
Headings
| H1 | H2 | H3 | H4 | H5 | H6 |
| 1 | 0 | 0 | 0 | 0 | 0 |
Images
We found 9 images on this web page.
Good, most or all of your images have alt attributes.
Text/HTML Ratio
Ratio : 4%
This page's ratio of text to HTML code is below 15 percent, this means that your website probably needs more text content.
Flash
Perfect, no Flash content has been detected on this page.
Iframe
Great, there are no Iframes detected on this page.
URL Rewrite
Good. Your links looks friendly!
Underscores in the URLs
Perfect! No underscores detected in your URLs.
In-page links
We found a total of 27 links including 0 link(s) to files
| Anchor | Type | Juice |
|---|---|---|
| Zum Inhalt springen | Internal | Passing Juice |
| Paulas Beauty Home | Internal | Passing Juice |
| Produkte | Internal | Passing Juice |
| Buchung | Internal | Passing Juice |
| Behandlungen | Internal | Passing Juice |
| Cookie-Richtlinie (EU) | Internal | Passing Juice |
| Datenschutzerklärung | Internal | Passing Juice |
| Geschäftsbedingungen | Internal | Passing Juice |
| Glossar | Internal | Passing Juice |
| Kommentare | Internal | Passing Juice |
| Mein Blog | Internal | Passing Juice |
| Mesotherapie / Mesolift | Internal | Passing Juice |
| Micro Needling | Internal | Passing Juice |
| Micropigmentur | Internal | Passing Juice |
| Neuigkeiten / Trends | Internal | Passing Juice |
| Permanent Make Up | Internal | Passing Juice |
| Plasmalifting | Internal | Passing Juice |
| Über mich | Internal | Passing Juice |
| Wimpernverlängerungen (Lashes) | Internal | Passing Juice |
| Willkommen bei Paula Beauty ! | Internal | Passing Juice |
| Wimpernverlängerungen (Lashes) | Internal | Passing Juice |
| Mikroneedling | Internal | Passing Juice |
| Plasmalifting | Internal | Passing Juice |
| Mesotherapie | Internal | Passing Juice |
| Seetalstrasse 92, 6032 Emmen | External | Passing Juice |
| Sprache | Internal | Passing Juice |
| Lesen Sie mehr über diese Zwecke | External | Passing Juice |
Keywords Cloud
behandlungen die und wir auf emmen sie paula beauty bei
Keywords Consistency
| Keyword | Content | Title | Keywords | Description | Headings |
|---|---|---|---|---|---|
| sie | 18 | ![]() |
![]() |
![]() |
![]() |
| und | 17 | ![]() |
![]() |
![]() |
![]() |
| bei | 10 | ![]() |
![]() |
![]() |
![]() |
| auf | 7 | ![]() |
![]() |
![]() |
![]() |
| emmen | 7 | ![]() |
![]() |
![]() |
![]() |
Url
Domain : paulabeauty.ch
Length : 14
Favicon
Great, your website has a favicon.
Printability
We could not find a Print-Friendly CSS.
Language
Good. Your declared language is de.
Dublin Core
This page does not take advantage of Dublin Core.
Doctype
HTML 5
Encoding
Perfect. Your declared charset is UTF-8.
W3C Validity
Errors : 0
Warnings : 0
Email Privacy
Warning! At least one email address has been found in the plain text. Use free antispam protector to hide email from spammers.
Deprecated HTML
Great! We haven't found deprecated HTML tags in your HTML.
Speed Tips
![]() |
Excellent, your website doesn't use nested tables. |
![]() |
Too bad, your website is using inline styles. |
![]() |
Too bad, your website has too many CSS files (more than 4). |
![]() |
Too bad, your website has too many JS files (more than 6). |
![]() |
Too bad, your website does not take advantage of gzip. |
Mobile Optimization
![]() |
Apple Icon |
![]() |
Meta Viewport Tag |
![]() |
Flash content |
XML Sitemap
Great, your website has an XML sitemap.
| https://paulabeauty.ch/sitemap_index.xml |
Robots.txt
http://paulabeauty.ch/robots.txt
Great, your website has a robots.txt file.
Analytics
Missing
We didn't detect an analytics tool installed on this website.
Web analytics let you measure visitor activity on your website. You should have at least one analytics tool installed, but It can also be good to install a second in order to cross-check the data.
Website-SEO-Überprüfung is a free SEO tool which provides you content analysis of the website.