Generated on February 24 2026 15:53 PM
Old data? UPDATE !
The score is 52/100
Title
ktipp.ch
Length : 8
Ideally, your title should contain between 10 and 70 characters (spaces included). Use this free tool to calculate text length.
Description
konsuminfo.ch - das Schweizer Konsumentenportal mit vielen Informationen zu den Themen Geld, Gesundheit, Wohnen, Arbeit, Kommunikation, Versicherungen, Konsum und Reisen.
Length : 170
Ideally, your meta description should contain between 70 and 160 characters (spaces included). Use this free tool to calculate text length.
Keywords
Very bad. We haven't found meta keywords on your page. Use this free online meta tags generator to create keywords.
Og Meta Properties
Good, your page take advantage of Og Properties.
| Property | Content |
|---|---|
| title | K-Tipp |
| description | das Schweizer Konsumentenportal mit vielen Informationen zu den Themen Geld, Gesundheit, Wohnen, Arbeit, Kommunikation, Versicherungen, Konsum und Reisen. |
| image | /fileadmin/content/magazine/ktipp/2026/03/Bilder/KT-0326-Cover.jpg |
Headings
| H1 | H2 | H3 | H4 | H5 | H6 |
| 1 | 46 | 1 | 0 | 0 | 0 |
Images
We found 35 images on this web page.
2 alt attributes are empty or missing. Add alternative text so that search engines can better understand the content of your images.
Text/HTML Ratio
Ratio : 24%
Good, this page's ratio of text to HTML code is higher than 15, but lower than 25 percent.
Flash
Perfect, no Flash content has been detected on this page.
Iframe
Too Bad, you have Iframes on the web pages, this mean that content in an Iframe cannot be indexed.
URL Rewrite
Bad. Your links have query string.
Underscores in the URLs
We have detected underscores in your URLs. You should rather use hyphens to optimize your SEO.
In-page links
We found a total of 89 links including 1 link(s) to files
| Anchor | Type | Juice |
|---|---|---|
| Internal | noFollow | |
| - | Internal | Passing Juice |
| Kontakt | Internal | Passing Juice |
| Newsletter | Internal | Passing Juice |
| Über uns | Internal | Passing Juice |
| ANMELDEN | Internal | Passing Juice |
| - | External | Passing Juice |
| - | Internal | Passing Juice |
| - | Internal | Passing Juice |
| Tests | Internal | Passing Juice |
| Produktetests | Internal | Passing Juice |
| Testsieger | Internal | Passing Juice |
| Degustationen | Internal | Passing Juice |
| Beratung | Internal | Passing Juice |
| Rechtsberatung | Internal | Passing Juice |
| Konsumberatung | Internal | Passing Juice |
| Service | Internal | Passing Juice |
| Musterbriefe | Internal | Passing Juice |
| Musterverträge | Internal | Passing Juice |
| Merkblätter | Internal | Passing Juice |
| Warnlisten | Internal | Passing Juice |
| Rechner | Internal | Passing Juice |
| Zinsvergleiche | Internal | Passing Juice |
| Schlüsselfundmarke | Internal | Passing Juice |
| App | External | Passing Juice |
| Shop | Internal | Passing Juice |
| Versicherungen | Internal | Passing Juice |
| Rechtsschutz | Internal | Passing Juice |
| Haushalt | Internal | Passing Juice |
| ePaper | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Internal | Passing Juice | |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Internal | Passing Juice | |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Internal | Passing Juice | |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Internal | Passing Juice | |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Internal | Passing Juice | |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Weiter | Internal | Passing Juice |
| Inhalt | Internal | Passing Juice |
| PDF-Archiv | Internal | Passing Juice |
| PDF-Archiv K-Tipp Wohnen | Internal | Passing Juice |
| Mehr erfahren | External | Passing Juice |
| Mehr erfahren | External | Passing Juice |
| Test: Kaum Pestizide in Nassfutter für Katzen | Internal | Passing Juice |
| Test: Sehr gute Socken für weniger als 3 Franken | Internal | Passing Juice |
| Test: Giftstoffe in vielen Avocados | Internal | Passing Juice |
| Offene Stellen | Internal | Passing Juice |
| Impressum | Internal | Passing Juice |
| Inserate | External | Passing Juice |
| Datenschutz | Internal | Passing Juice |
| update AG | External | Passing Juice |
Keywords Cloud
weiter sie das k-tipp ich httpswwwktippchfileadmintemplatesfaviconktippapple-icon-180x180png die und der für
Keywords Consistency
| Keyword | Content | Title | Keywords | Description | Headings |
|---|---|---|---|---|---|
| k-tipp | 42 | ![]() |
![]() |
![]() |
![]() |
| weiter | 42 | ![]() |
![]() |
![]() |
![]() |
| httpswwwktippchfileadmintemplatesfaviconktippapple-icon-180x180png | 36 | ![]() |
![]() |
![]() |
![]() |
| der | 30 | ![]() |
![]() |
![]() |
![]() |
| die | 29 | ![]() |
![]() |
![]() |
![]() |
Url
Domain : konsuminfo.ch
Length : 13
Favicon
Great, your website has a favicon.
Printability
We could not find a Print-Friendly CSS.
Language
Good. Your declared language is de.
Dublin Core
This page does not take advantage of Dublin Core.
Doctype
HTML 5
Encoding
Perfect. Your declared charset is UTF-8.
W3C Validity
Errors : 0
Warnings : 0
Email Privacy
Great no email address has been found in plain text!
Deprecated HTML
Great! We haven't found deprecated HTML tags in your HTML.
Speed Tips
![]() |
Excellent, your website doesn't use nested tables. |
![]() |
Too bad, your website is using inline styles. |
![]() |
Great, your website has few CSS files. |
![]() |
Perfect, your website has few JavaScript files. |
![]() |
Perfect, your website takes advantage of gzip. |
Mobile Optimization
![]() |
Apple Icon |
![]() |
Meta Viewport Tag |
![]() |
Flash content |
XML Sitemap
Great, your website has an XML sitemap.
| https://www.ktipp.ch/sitemap.xml |
Robots.txt
http://konsuminfo.ch/robots.txt
Great, your website has a robots.txt file.
Analytics
Great, your website has an analytics tool.
Google Analytics |
Website-SEO-Überprüfung is a free SEO tool which provides you content analysis of the website.